PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010929380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 318aa    MW: 35715.2 Da    PI: 8.3191
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010929380.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.32.4e-56101371128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL +k+++ ++++ ++i+evd++k+ePwdLp+k+k +ekewyfF  rd+ky+tg r+nrat++gyWk+tgkdke++s 
  XP_010929380.1  10 LPPGFRFHPTDEELITFYLSHKISEANFSA-RAITEVDLNKCEPWDLPAKAKMGEKEWYFFNLRDRKYPTGVRTNRATNAGYWKTTGKDKEIFSG 103
                     79**************************99.89***************99999****************************************97 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++elvg+kktLvfykgrap+gekt+Wvmheyrl
  XP_010929380.1 104 qTSELVGMKKTLVFYKGRAPRGEKTNWVMHEYRL 137
                     57778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-648163IPR003441NAC domain
PROSITE profilePS5100560.64710163IPR003441NAC domain
PfamPF023652.0E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEGGDKEEQL PPGFRFHPTD EELITFYLSH KISEANFSAR AITEVDLNKC EPWDLPAKAK  60
MGEKEWYFFN LRDRKYPTGV RTNRATNAGY WKTTGKDKEI FSGQTSELVG MKKTLVFYKG  120
RAPRGEKTNW VMHEYRLQSK SATKANKAID MQDEWVVCRV FMKSSSGKKY LSSQSRGNPY  180
HHHHHHHLGM VQPEAPHFGV GGRNYLTTSA DLAELSRFAR GTPGSNLPIQ PQFDFPPFTL  240
SGLNVGLGGQ RTMPPVPLPH QPQLVAEPTS SVLANSCVMA ADEGFNADVL VTSTGTGGRY  300
HQQIDPCVEF DQGYWPSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-561016917171NO APICAL MERISTEM PROTEIN
1ut4_B2e-561016917171NO APICAL MERISTEM PROTEIN
1ut7_A2e-561016917171NO APICAL MERISTEM PROTEIN
1ut7_B2e-561016917171NO APICAL MERISTEM PROTEIN
3swm_A3e-561016920174NAC domain-containing protein 19
3swm_B3e-561016920174NAC domain-containing protein 19
3swm_C3e-561016920174NAC domain-containing protein 19
3swm_D3e-561016920174NAC domain-containing protein 19
3swp_A3e-561016920174NAC domain-containing protein 19
3swp_B3e-561016920174NAC domain-containing protein 19
3swp_C3e-561016920174NAC domain-containing protein 19
3swp_D3e-561016920174NAC domain-containing protein 19
4dul_A2e-561016917171NAC domain-containing protein 19
4dul_B2e-561016917171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010929380.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like isoform X1
SwissprotO040172e-79NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLM0TJ051e-140M0TJ05_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P19680_0011e-140(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP93613846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.22e-93NAC domain containing protein 38